-
1 Randbreite
Rand·brei·tef TYPO margin width -
2 Randbreite
f < doku> ■ margin width -
3 largo
(pl -ghi) 1. adj wide, broadindumento loose, big( abbondante) large, generouslargo di manica generous2. m width( piazza) squareandare al largo head for the open seaal largo di off the coast offarsi largo elbow one's way throughstare alla larga da steer clear of, keep away from* * *largo agg.1 (esteso, ampio) wide, broad: un fosso largo dieci metri, a ditch ten-metres wide; un fiume largo, a wide (o broad) river; la nuova autostrada è larga venti metri, the new motorway is twenty metres wide; quanto deve essere largo il tavolo?, how wide does the table have to be?; il fico ha le foglie larghe, the fig tree has broad leaves; cappello con larghe falde, broad-brimmed hat; queste scarpe mi stanno larghe, these shoes are too big for me; avere le spalle larghe, (anche fig.) to have broad shoulders; a larghi intervalli, at broad intervals; una larga parte della popolazione vive nel sud, much of the population lives in the south; una larga estensione di deserto, a broad expanse of desert // è più largo che lungo, he's roly-poly // quando studio mi piace stare largo, when I study I like to have a lot of space // ti conviene stare largo, poi se spendi meno meglio, you'd better allow (o calculate) a bit extra, then if you spend less, so much the better; meglio stare larghi nei preventivi, you'd better calculate a bit extra in the estimate // uomo di larghe vedute, broadminded man // termine usato in senso largo, term used in a broad sense; devi interpretare la sua tesi in senso largo, you have to interpret his thesis in a broad sense // è una curva pericolosa, prendila larga, it's a dangerous curve, take it wide; non prenderla troppo larga, vieni subito al dunque, (fig.) don't beat about the bush, come to the point2 (lasco; allentato) loose: un nodo largo, a loose knot; una fasciatura largo, a loose bandage3 (di indumenti) (ampio) loose-fitting; (eccessivo di misura) big; loose; too wide: vanno di moda le gonne larghe, full skirts are in fashion; mi piacciono i maglioni larghi, I like loose-fitting sweaters; questa gonna mi è larga in vita, this skirt is loose in the waist; la giacca è larga di spalle, this jacket is too wide in the shoulder; queste scarpe sono troppo larghe, these shoes are too big4 (abbondante) large, wide: una larga ricompensa, a large reward; avere una larga parte nella direzione, to have a large share in management; larghi poteri, large powers; un largo margine di guadagno, di sicurezza, a wide margin of profit, of safety; quell'articolo è prodotto su larga scala, that article is produced on a large scale; fare larghe concessioni, to make big concessions // i turisti hanno preferito in larga misura il mese di agosto, tourists showed a marked preference for August5 (liberale) free, liberal, generous: largo di promesse, free with promises; è largo nelle mance, he is a generous tipper; è largo con gli amici, he is generous with his friends // essere di manica larga, to be easy going6 (di pronuncia) broad: ha un accento largo, he has a broad accent7 ( sport) (scherma) guardia larga, open guard8 (pitt.) bold: pennellata larga, bold brushwork◆ s.m.1 breadth, width: metti giù il tappeto per il largo, put down the carpet lengthwise; ho visitato la città in lungo e in largo, I have been all over (o over the length and breadth of) the city; estendersi in largo, to stretch sideways; fare largo (a qlcu.), to make room (for s.o.) // farsi largo, (anche fig.) to make one's way: farsi largo tra la folla, to make (o to push) one's way through the crowd // largo!, make way!; largo ai giovani!, make way for the young! // tieniti al largo da certa gente, keep clear of certain people2 (mar.) open sea, offing: la nave si tenne al largo, the ship stood offshore (o in the offing); andare al largo, to take to the open sea; dieci miglia al largo, ten miles out to sea; passare al largo di una nave, to give a ship a wide berth; prendere il largo, to set sail (o to leave port); (fig.) to run away // al largo di, off: al largo di Genova, off Genoa3 (mus.) largo: il 'Largo' di Händel, Händel's 'Largo'4 (piazza) square; (seguito da nome proprio) largo: troviamoci in Largo Battisti, we will meet in Largo Battisti◆ avv. wide: girare largo, to turn wide.* * *['larɡo] largo -a, -ghi, -ghe1. agg1) (dimensione, misura) wide, broadun uomo largo di spalle o di spalle larghe — a broad-shouldered man
3) (ampio: parte, percentuale) large, bigin larga misura — to a great o large extent
di larghe vedute — (fig : liberale) broad-minded
di manica larga fig — generous, open-handed
2. sm1)fate largo! — make room o way!
farsi largo tra la folla — to make o push one's way through the crowd
si è fatta largo tra la folla ed è salita sul palco — she pushed her way through the crowd and went up on the stage
2) (piazzetta) (small) square3) Naut open seanon andare al largo — (nuotando) don't go too far out
prendere il largo — to put out to sea, fig to make off, escape
4) Mus largo3. sfstare o tenersi alla larga (da qn/qc) — to keep one's distance (from sb/sth), keep away (from sb/sth)
* * *1.1) [fronte, spalle, fianchi] broad; [corridoio, fiume, letto] wide3) (grande, notevole) [ maggioranza] large; [ pubblico] wide; [ consenso] widespreadin -a misura — o
parte — in large measure, to a large o great extent
4) (generoso) [ persona] generous ( con to)5) (aperto)di -ghe vedute — broadminded, open-minded
6) (lento) [nodo, fasciatura] loose7) alla largastare alla -a da qcn., qcs. — to give sb., sth. a wide berth, to keep away from sb., sth.
tenere qcn., qcs. alla -a da qcn. — to keep sb., sth. out of sb.'s way
2.prendere qcs. alla -a — to approach sth. in a roundabout way
sostantivo maschile1) (larghezza) breadth, width2) mar. (mare aperto) open seaprendere il largo — to push off, to put (out) to sea; colloq. fig. to do a bunk
al largo — offshore, off the coast
cercare qcs. in lungo e in largo — to hunt high and low o far and wide for sth.
4) mus. largo5) (slargo)3.avverbio mus. largo••farsi largo — to push (one's way) ( tra through)
••stare -ghi — colloq. (avere molto spazio) to have plenty of room
Note:Come mostrano le diverse accezioni dell'aggettivo largo qui sotto elencate, i principali equivalenti inglesi di largo sono wide e broad. - In termini molto generali, si può dire che wide indichi soprattutto l'ampiezza di qualcosa ( un fiume largo = a wide river), mentre broad si usa spesso in relazione alle parti del corpo ( spalle larghe = broad shoulders) o per descrivere qualcosa che è piacevolmente largo ( un largo viale alberato = a broad tree-lined avenue). - Per gli altri usi ed equivalenti dell'italiano largo, si veda la voce qui sotto* * *largoCome mostrano le diverse accezioni dell'aggettivo largo qui sotto elencate, i principali equivalenti inglesi di largo sono wide e broad. - In termini molto generali, si può dire che wide indichi soprattutto l'ampiezza di qualcosa ( un fiume largo = a wide river), mentre broad si usa spesso in relazione alle parti del corpo ( spalle larghe = broad shoulders) o per descrivere qualcosa che è piacevolmente largo ( un largo viale alberato = a broad tree-lined avenue). - Per gli altri usi ed equivalenti dell'italiano largo, si veda la voce qui sotto. ⇒ 211 [fronte, spalle, fianchi] broad; [corridoio, fiume, letto] wide; quanto è largo? how wide is it? essere largo 4 metri to be 4 metres wide2 (ampio) [indumento, pantalone] loose(-fitting), roomy, baggy; [ gonna] full; mi va un po' largo it's a bit loose; largo in vita loose in the waist3 (grande, notevole) [ maggioranza] large; [ pubblico] wide; [ consenso] widespread; una -a parte dei presenti most of those present; su -a scala far-reaching; con largo margine by a wide margin; in -a misurao parte in large measure, to a large o great extent5 (aperto) di -ghe vedute broadminded, open-minded6 (lento) [nodo, fasciatura] loose7 alla larga stare alla -a da qcn., qcs. to give sb., sth. a wide berth, to keep away from sb., sth.; tenere qcn., qcs. alla -a da qcn. to keep sb., sth. out of sb.'s way; prendere qcs. alla -a to approach sth. in a roundabout way1 (larghezza) breadth, width2 mar. (mare aperto) open sea; prendere il largo to push off, to put (out) to sea; colloq. fig. to do a bunk; al largo offshore, off the coast; al largo di Napoli off Naples3 in lungo e in largo cercare qcs. in lungo e in largo to hunt high and low o far and wide for sth.; ha visitato la Francia in lungo e in largo he's travelled all over France4 mus. largo5 (slargo) Largo Francia Francia placeIII avverbiomus. largoavere le spalle -ghe to have a broad back; fate largo! make way! farsi largo to push (one's way) ( tra through); stare -ghi colloq. (avere molto spazio) to have plenty of room. -
4 large
large [laʀʒ]1. adjectivea. ( = grand) wide ; [lame, dos, visage, main, nez, front] broad ; [jupe] full ; [chemise] loose-fitting ; [pantalon] baggyb. [pouvoirs, diffusion, extraits] extensive ; [choix, gamme] widec. ( = généreux) generousd. ( = tolérant) il est large d'esprit2. adverb• prends un peu plus d'argent, il vaut mieux prévoir large take a bit more money, it's better to allow a bit extra3. masculine nouna. ( = largeur) une avenue de 8 mètres de large an avenue 8 metres wideb. ( = haute mer) le large the open sea* * *laʀʒ
1.
1) ( de grande dimension) [épaules, hanches, paumes] broad; [couloir, avenue, rivière, lit] wide; [sillon] broad; [manteau] loose-fitting; [pantalon] loose; [jupe, cape] full; [chandail] big; [geste, mouvement] sweeping; [sourire] broad; [courbe, détour] longlarge de trois mètres — three metres [BrE] wide
2) ( important) [avance, bénéfice] substantial; [choix, public] wide; [concertation, coalition] broad; [extrait, majorité] large4) ( ais é) [vie] comfortable5) ( ouvert)avoir les idées larges, être large d'esprit — to be broad-minded
2.
1) ( généreusement) [prévoir] on a generous scale; [calculer, mesurer] on the generous side2)
3.
nom masculin1) ( largeur)faire quatre mètres de large — to be four metres [BrE] wide
2) Nautisme open seaprendre le large — Nautisme to sail; grand
••ne pas en mener large — (colloq) to be worried stiff (colloq)
* * *laʀʒ1. adj1) (passage, boulevard, étendue, couverture, éventail) wide, (majorité) large, (épaules, visage, sourire) broad2)3) fig (= généreux) generous2. adv1) [voir, prévoir, calculer]Nous avons préféré voir large au cas où les invités viendraient avec leurs familles. — We thought we'd better allow plenty in case our guests brought their families.
En calculant large, je pense que l'on devrait être à Édimbourg dans une heure. — Allowing plenty of time, I think we should be in Edinburgh in an hour.
2)3. nm1) (= largeur)5 m de large — 5 m wide, 5 m in width
2) (= mer)Le bateau est actuellement au large du Portugal. — The boat is off the coast of Portugal at the moment.
3)en long et en large [expliquer, décrire, parcourir] — in every detail
* * *A adj1 ⇒ Les mesures de longueur ( de grande dimension) [front, épaules, hanches, paumes, nez] broad; [couloir, avenue, rivière, lit] wide; [sillon] broad; [manteau] loose-fitting; [pantalon] loose; [jupe, cape] full; [chandail] big; [geste, mouvement] sweeping; [sourire] broad; [courbe, détour] long; une caisse aussi large que haute a box as wide as it is high; faire de larges gestes des bras to make sweeping gestures with one's arms; former un large cercle to form a big circle; être large d'épaules/de hanches to have broad shoulders/hips; être large de trois mètres to be three metresGB wide;2 ( important) [avance, bénéfice] substantial; [choix, gamme, public] wide; [concertation, coalition] broad; [extrait, majorité] large; remporter une large victoire to win by a wide margin; dans une large mesure, pour une large part to a large extent; au sens large in a broad sense; prendre une large part dans qch to take a large part in sth; bénéficier d'un large soutien to have widespread support;3 ( généreux) [personne] generous (avec to);5 ( ouvert) avoir les idées larges, être large d'idées to be broad-minded, to be liberal; avoir l'esprit large, être large d'esprit to be broad-minded.B adv1 ( généreusement) [prévoir] on a generous scale; [calculer, mesurer] on the generous side; il vaut mieux prévoir large it's better to plan on a generous scale; et quand je dis dix je suis large○! and when I say ten I'm erring on the generous side!; trois kilos de spaghetti, tu as vu large○! three kilos of spaghetti, you don't believe in skimping, do you?;2 Mode s'habiller large to wear loose-fitting clothes; un modèle qui chausse large a wide-fitting shoe.C nm1 ( largeur) faire quatre mètres de large to be four metresGB wide; un ruban de deux centimètres de large a ribbon five centimetresGB wide; être au large○ to have plenty of room;2 Naut open sea; gagner le large to reach the open sea; au large offshore; au large de Marseille/des côtes bretonnes off Marseilles/the coast of Brittany; l'air/le vent du large the sea air/breeze; prendre le large Naut to sail; fig○ to make oneself scarce○; ⇒ grand.ne pas en mener large○ to be worried stiff○.[larʒ] adjectif3. [considérable] largeelle a une large part de responsabilité she must bear a large ou major share of the blameavoir un large vocabulaire to have a wide ou wide-ranging vocabularyelle a fait de larges concessions/un large tour d'horizon she made generous concessions/an extensive survey of the situationles journaux ont publié de larges extraits de son discours the papers quoted extensively from his speech4. [généralementéral]5. [généralementéreux] generous6. [ouvert] openleur père a l'esprit large their father is open-minded ou broad-minded7. [excessif]————————[larʒ] nom masculin1. [dimension] width2. NAUTIQUEau large offshore, at sea————————[larʒ] adverbecalculer ou prévoir large to allow a good margin for error————————en large locution adverbiale -
5 интервал
1) General subject: breach, break, gap, interim, interregnum, interspace, interval, parenthesis, space, span, spacing ( in a document)3) Military: gap, intervening gap4) Engineering: distance, domain, following distance (между автомобилями), head (между автомобилями), headway (на транспорте), latitude (фотографическая), period, step (шкалы), window, zone (ствола скважины)5) Chemistry: band, separation6) Mathematics: class (значений), cycle (времени), doubly infinite interval, horizon, monospace, open interval7) Railway term: interstice, margin (между поездами)9) Accounting: bracket (значений)10) Automobile industry: margin (между автомобилями)11) Mining: headway (между автомобилями), space interval12) Cinema: slot13) Metallurgy: intermediate space14) Electronics: sound interval15) Information technology: domain (времени), dwell (для принятия решений), extent, lag (времени), spanning, timeslice16) Oil: interval (расстояние по вертикали между двумя точками ствола скважины), section (в скважине), spot (цементирования, прострела, закрытия воды, кислотной обработки), zone (в скважине), spacing17) Geophysics: bandwidth, clearance, gate, region18) Silicates: (температурный) range19) Metrology: (пространственный или временной) spacing20) Ecology: time step, working time interval22) EBRD: bubble trades23) Polymers: margin25) Quality control: class (значении)26) Makarov: arm, bay, belt (в статистике), diapason, division, dwell (выделенный для принятия решения), gamut, gap (расстояние), head (на транспорте), in-between, length, offtime (напр. между импульсами), path, range (диапазон), region (диапазон), run, separation (расстояние), slot (в системах с временным разделением), spacing (линии связи), spacing (расстояние), span (линии связи), width27) Gold mining: intersept -
6 ширина шва
1) Engineering: joint clearance, joint margin, seam margin2) Construction: joint gap width3) Sowing: margin4) Cement: joint opening -
7 Bandbreite
f1. Radio: frequency range, bandwidth2. Statistik: spread3. Börse: fluctuation margin4. von Warenangebot: range5. fig. range; bes. von Wissen etc.: spectrum* * *die Bandbreiteband width* * *Bạnd|brei|tef1) (RAD) waveband, frequency range* * *(a selection or variety: a wide range of books for sale; He has a very wide range of interests.) range* * *Band·brei·tef1. (geh) range2. FIN variationeine \Bandbreite von... bis... haben to range from... to...3. RADIO, INET bandwidth* * *die (fig.) range* * *1. Radio: frequency range, bandwidth2. Statistik: spread3. BÖRSE fluctuation margin4. von Warenangebot: range5. fig range; besonders von Wissen etc: spectrum* * *die (fig.) range* * *(Frequenz) f.bandwidth (radio) n. f.range n.spectrum n.(§ pl.: spectrums, or: spectra) -
8 Mindestangebot
Mindestangebot
lowest tender (bid, offer);
• Mindestanspruch minimum claim;
• Mindestanzahl minimum number;
• Mindestanzahlung minimum down payment (US);
• Mindestarbeitszeit minimum working hours;
• wöchentliche Mindestarbeitszeit minimum work week;
• garantierte Mindestauflage (Zeitung) guaranteed minimum circulation;
• Mindestausleihungssatz minimum lending rate (Br.), prime rate (US);
• Mindestauswirkung auf die Beschäftigungslage minimal employment;
• Mindestbarzahlung minimum cash payment;
• Mindestbedarf minimum supply (demand);
• Mindestbedarf an Nahrungsmitteln minimum food needs;
• Mindestbeitrag minimum contribution;
• garantierte Mindestbeschäftigung guaranteed employment;
• Mindestbeschäftigungszeit minimum period of employment;
• Mindestbestand minimum inventory;
• Mindestbesteuerung minimum taxation;
• Mindestbeteiligung beim Ersterwerb (Kapitalanlagegesellschaft) minimum initial subscription;
• Mindestbetrag minimal amount, minimum;
• garantierte Mindestbezahlung guarantee pay;
• Mindestbezug minimum purchase;
• Mindestbietender lowest bidder;
• Mindestbreite (Anzeige) minimum width;
• Mindestcourtagesatz minimum commission rate;
• Mindestdeckung minimum margin requirements;
• Mindestdiskontsatz minimum lending (interest) rate (Br.), prime rate (US);
• Mindesteinfuhrpreis (EU) minimum import price;
• Mindesteinheitskosten unit cost standard;
• Mindesteinheitssätze minimum standard rates;
• Mindesteinkommen minimum income;
• einkommensteuerpflichtiges Mindesteinkommen threshold income;
• Mindesteinkommensgrenze unterschreiten to be below the poverty line;
• Mindesteinkommenssteuersatz income-tax standard rate, threshold tariff;
• Mindesteinkommensziffer minimum income figure;
• Mindesteinlage minimum investment, (Bank) minimum deposit;
• bei der Landeszentralbank unterhaltene Mindesteinlagen memberbank balance held as reserve (US);
• kalkulierte Mindesteinnahmen price expectancy;
• Mindesteinspielergebnisse minimum return;
• Mindesteinzahlungsbetrag margin requirements (US);
• Mindesterfordernisse minimum requirements;
• Mindestertrag minimum return, lowest (minimum) yield;
• Mindestfordernder lowest contractor;
• Mindestforderung minimum claim;
• Mindestfracht lowest (minimum) freight, minimum bill of lading;
• Mindestfrachtsatz minimum freight rate;
• Mindestfreibetrag (Steuer) exemption minimum;
• feststehender Mindestfreibetrag (Einkommensteuer) minimum standard deduction;
• Mindestfrist minimum time period;
• Mindestgebot (Auktion) put-up (reserved) price, lowest bid;
• Mindestgebühr minimum fee, (Post) minimum charge;
• Mindestgehalt minimum salary, (in der Montanindustrie) lowest percentage;
• Mindestgewicht minimum weight, (Papier) basic weight, (Waggonladung) minimum carload weight (US);
• Mindestgrenze minimum (lower) limit, (Selbstbehalt, Haftpflicht) franchise (Br.);
• Mindestgrenze für Haftungsschäden basic minimum limit of liability;
• Mindestgröße (Anzeige) minimum linage;
• wirtschaftliche Mindestgröße minimum economic size;
• Mindestguthaben compensating balance;
• Mindesthaltbarkeitsdatum (MHD) sell-by date;
• Mindesthöhe für Schadenersatz minimum level for compensation;
• Mindestinventar basic stock;
• Mindestkapazität marginal capacity;
• Mindestkapital minimum of (minimum paid-in, US) capital;
• Mindestkleinverkaufspreis minimum retail price;
• Mindestkosten minimum cost;
• gesetzliche Mindestkündigungsfrist statutory minimum period of notice;
• Mindestkurs (Devisen) minimum rate (price);
• Mindestleistung (Akkordlohn) task, (Produktion) minimum capacity, (Versicherung) minimum terms and period of insurance;
• automatisch angepasste Mindestleistung shifting minimum. -
9 groß
big; tall; great; large; grand; heavyset* * *[groːs]1. ADJEKTIVcomp ordm;er ['grøːsɐ] superl ordm;te(r, s) ['grøːstə]1) big; Fläche, Raum, Haus, Hände big, large; Höhe, Breite great; Größe, Tube, Dose, Packung etc large; (TYP ) Buchstabe capitalein ganz großes Haus/Buch — a great big house/book
der große ( Uhr)zeiger — the big or minute hand
x ist größer als 10 (Math) — x is greater than 10
ein 2 Hektar großes Grundstück — a 2-hectare plot of land
ein Loch größer machen — to make a hole bigger
ein großes Bier, ein Großes (inf) — ≈ a pint (of beer) (Brit), a large beer
die große Masse (fig) — the vast majority
2) = hoch, hochgewachsen taller ist 1,80 Meter groß — he's one metre (Brit) or meter (US) eighty (tall)
unsere Große — our eldest or oldest (daughter); (von zweien) our elder daughter
unser Großer — our eldest or oldest ( son); (von zweien) our elder son
mit etw groß geworden sein — to have grown up with sth
er ist ein großes Kind — he's a big or a great big (inf) baby
4) zeitlich Verzögerung, Rede big, longdie große Pause (Sch) — the long or lunch break
die großen Ferien — the summer holidays (Brit) or holiday (US)
5) = beträchtlich, wichtig, bedeutend great; Erfolg, Enttäuschung, Hoffnung, Eile great, big; Gewinn, Ereignis big; Katastrophe, Schreck terrible; Summe large; Geschwindigkeit higher hat Großes geleistet — he has achieved great things
die größten Erfindungen unseres Jahrhunderts — the greatest inventions of our century
ein großer Dichter wie Goethe — a great poet like Goethe
eine große Dummheit machen — to do something very or really stupid
er ist kein großer Esser (inf) — he's not a big eater
eine der größeren Firmen — one of the major companies
die großen Fragen unserer Zeit — the great or big questions of our time
das große Ganze — the broader or wider view
vor meinem Haus war or herrschte ein großer Lärm — there was a lot of noise outside my house
ich habe große Lust zu verreisen — I'd really like to go away (on holiday (Brit) or vacation (US))
sie hatte große Lust, sich zu verkleiden — she really wanted to get dressed up
einen großen Namen haben — to be a big name
ich bin kein großer Redner (inf) — I'm no great speaker
ich bin kein großer Opernfreund (inf) — I'm not a great opera fan
im größten Regen/Schneesturm — in the middle of a downpour/snowstorm
große Worte machen — to use grand words
6) = großartig, bewundernswert iro greatdas ist or finde ich ganz groß (inf) — that's really great (inf)
7) in Eigennamen GreatAlfred/Friedrich der Große — Alfred/Frederick the Great
8) MUS2. ADVERBcomp ordm; er, superl am ordm;ten1)groß machen (baby-talk) — to do number two (baby-talk), to do a poo (Brit baby-talk)
groß daherreden (inf) — to talk big (inf)
See:2)3)was ist das schon groß? (inf) — big deal! (inf), so what? (inf)
was soll man da schon groß machen/sagen? (inf) — what can you do/say?
er hat sich nicht gerade groß für unsere Belange eingesetzt (inf) — he didn't exactly put up a big fight for us
ich habe mich nie groß um Politik gekümmert (inf) — I've never been a great one for politics (inf)
ich kümmere mich nicht groß darum (inf) — I don't take much notice
ganz groß rauskommen (inf) — to make the big time (inf)
* * *1) (large in size: a big car.) big2) (very large, larger etc than average: a great crowd of people at the football match.) great3) (great in size, amount etc; not small: a large number of people; a large house; a large family; This house is too large for two people.) large4) (fairly large: His income is quite sizeable, now that he has been promoted.) sizeable5) ((of people and thin or narrow objects such as buildings or trees) higher than normal: a tall man/tree.) tall6) ((of people) having a particular height: John is only four feet tall.) tall7) (great or large: He won by a wide margin.) wide* * *<größer, größte>[ˈgro:s]I. adjin \großen/größeren Formaten/Größen in large/larger formats/sizes2. (hoch aufragend) longein \großer Kirchturm/Mast/Turm a high church steeple/pylon/tower3. (hoch gewachsen) Mensch talldu bist \groß geworden you've grownwie \groß bist du? how tall are you?er ist 1,78 m \groß he is 5 foot 10 [or 1.78m] [tall]ein \großer Baum/eine \große Vase a tall tree/vaseauf \große[r] Fahrt on a long journeydie \große Pause SCH mid-morning break5. (älter) big, elder, olderdas ist Anita, unsere G\große this is Anita, our eldestwenn ich \groß bin... when I'm grown up...mein \großer Bruder/meine \große Schwester my elder brother/my elder sisterG\groß und Klein young and old [alike]6. (mengenmäßig)im G\großen einkaufen to buy in bulkdie \große Masse most [or the majority] of the peopleein \großer Teil der Bevölkerung a large part of the population7. (erheblich, beträchtlich) greatwas für eine \große Freude! how delightful!du redest ganz \großen Unsinn you're talking complete rubbishwas ist denn das für ein \großer Lärm auf der Straße? what's all that noise in the street?macht doch nicht so einen \großen Lärm! don't make so much noise!\große Angst haben to be terribly afraid [or frightened]ein \großer Aufstieg a meteoric riseeine \große Beeinträchtigung a major impairmentein \großer Betrag a large amounteine \große Dummheit sheer stupidityein \großer Durchbruch/Reinfall a major breakthrough/disastereine \große Enttäuschung a great [or deep] [or profound] disappointmentmit \großer Geschwindigkeit at high [or great] speed\großen Hunger haben to be terribly hungry\großes Leid great [or deep] [or profound] sorrowein \großer Misserfolg an abject [or a dismal] failure\große Nachfrage a big demandeine \große Preissteigerung a massive price rise [or increase]ein \großer Schrecken a nasty fright\große Schwierigkeiten serious [or real] trouble\große Wut unbridled fury\großer Zorn deep [or profound] anger8. (bedeutend) greatetwas/nichts G\großes something/nothing greatsie hat in ihrem Leben nichts G\großes geleistet she never achieved anything great [or major] in her life, she did not achieve great things in her lifemit diesem Gemälde hat sie etwas G\großes geschaffen she has created something great [or profound] with this paintingein \großer Konzern/ein \großes Unternehmen a leading [or major] group/company9. (besonders gut) bigim Meckern ist sie ganz \groß she's quite good at moaningich bin kein \großer Esser/Trinker I'm not a big eater/drinkerich bin kein \großer Redner I'm no [or not a] great speaker10. (in Eigennamen)▪ ... der G\große... the GreatFriedrich der G\große Frederick the Great11. (großes Glas) large, bignach den drei \großen Bier war ich ziemlich angeheitert I felt quite merry fam [or fam tipsy] after three pints [of beer]12.▶ im G\großen und Ganzen [gesehen] on the whole, by and largeich habe nur \großes Geld I haven't any change on me; s.a. kleinII. advwas ist da jetzt schon \groß dabei! big deal! famer hat sich aber nicht gerade \groß für uns eingesetzt! he didn't exactly do very much [or put himself out much] for us!was soll man da schon \groß sagen? you can't really say very muchich habe mich nie \groß für Politik interessiert I've never been particularly interested in politics\groß einsteigen to go in for sth in a big waysie ist ganz \groß in die Politik eingestiegen she's gone into politics in a big way2. (von weitem Ausmaß)\groß angelegt large-scaleeine \groß angelegte Offensive a full-scale offensive [or attack3. MODE4. (nicht klein)5.* * *1.größer, größt... Adjektiv1) big; big, large <house, window, area, room, etc.>; large < pack, size, can, etc.>; great <length, width, height>; tall < person>große Eier/Kartoffeln — large eggs/potatoes
eine große Terz/Sekunde — (Musik) a major third/second
ein großes Bier, bitte — a pint, please
2) (eine bestimmte Größe aufweisend)1 m2/2 ha groß — 1 m2/2 ha in area
sie ist 1,75 m groß — she is 1.75 m tall
doppelt/dreimal so groß wie... — twice/three times the size of...
3) (älter) big <brother, sister>seine größere Schwester — his elder sister
unsere Große/unser Großer — our eldest or oldest daughter/son
4) (erwachsen) grown-up <children, son, daughter>[mit etwas] groß werden — grow up [with something]
die Großen — (Erwachsene) the grown-ups; (ältere Kinder) the older children
Groß und Klein — old and young [alike]
5) (lange dauernd) long, lengthy <delay, talk, explanation, pause>die großen Ferien — (Schulw.) the summer holidays or (Amer.) long vacation sing.
die große Pause — (Schulw.) [mid-morning] break
große Summen/Kosten — large sums/heavy costs
eine große Auswahl — a wide selection or range
7) (außerordentlich) great <pleasure, pain, hunger, anxiety, hurry, progress, difficulty, mistake, importance>; intense <heat, cold>; high < speed>ihre/seine große Liebe — her/his great love
ein großer Augenblick/Tag — a great moment/day
große Worte — grand or fine words
die Großen [der Welt] — the great figures [of our world]
die große Dame/den großen Herrn spielen — (iron.) play the fine lady/gentleman
10) (bedeutend) great, major < artist, painter, work>Katharina die Große — Catherine the Great; s. auch Karl
11) (wesentlich)die große Linie/der große Zusammenhang — the basic line/the overall context
in großen Zügen od. Umrissen — in broad outline
im Großen [und] Ganzen — by and large; on the whole
ein großes Herz haben — be great-hearted
13) (ugs.): (großspurig)2.1)groß geschrieben werden — (fig. ugs.) be stressed or emphasized
groß machen — (Kinderspr.) do number two (child lang.)
2) (ugs.): (aufwendig)3) (ugs.): (besonders) greatly; particularly4) (ugs.): (großartig)sie steht ganz groß da — she has made it big (coll.) or made the big time (coll.)
* * *A. adj1. big (besonders gefühlsbetont); Haus, Fläche etc: large; Land: vast; Baum, Gebäude etc: (hoch) tall; (riesig) huge; Person: tall;ein großes Gebäude a big(, tall) building;der Große Ozean GEOG the Pacific (Ocean);die Großen Seen GEOG the Great Lakes;große Zehe big toe;großer Buchstabe capital letter;Gut mit großem G good with a capital G;wir sprechen hier von Geiz mit einem großen G fig, pej we’re talking about meanness with a capital M here;groß machen/müssen kinderspr do/have to do big jobs2. an Ausmaß, Intensität, Wert etc: great; Fehler, Lärm, Unterschied etc: auch big; Entfernung: great, long; Geschwindigkeit: high; Hitze, Kälte, Schmerzen etc: intense; Kälte: auch severe; Verlust: heavy; Wissen: extensive, wide; (tief) profound; MUS, Intervall, Terz: major; Angeber, Angsthase, Feigling etc: terrible, dreadful;wir waren zu Hause eine große Familie we were a large family;große Ferien summer holiday(s), long vacation;zu meiner großen Freude to my great joy ( oder pleasure);wie komme ich an das große Geld? umg how do I get into the big money?;großes Glück haben be very lucky;großen Hunger haben be very hungry; stärker: be starving;große Mehrheit great majority;große Pause long (mid-morning) break;ein Fest im großen Rahmen a celebration on the grand scale;große Schritte machen make great progress;zum großen Teil largely, for the most part;3. mit Maßangabe:wie groß ist er? how tall is he?;er ist … groß he’s … (tall); das Grundstückist 600 m2groß is 600 metres (US -ers) square;gleich groß Personen: the same height, as tall as each other; Flächen, Kleidungsstücke etc: the same size;so groß wie ein Fußballfeld the size of a football pitch (US soccer field);war dreimal so groß wie der der Konkurrenz was three times that of our rivalsgroße Schwester big sister;groß werden Kinder: grow up;zu groß werden für outgrow sth, get too big for;er ist nur ein großes Kind he’s just a big baby;Groß und Klein young and old5. fig Augenblick, Entdeckung, Erfolg, Tag, Tat etc: great; (bedeutend) major, important; (großartig) grand, magnificent; Pläne, Ziele: great, grand, big; Künstler, Dichter etc: great;große Worte big words;Friedrich der Große Frederick the Great;Karl der Große Charlemagne;die große Dame/den großen Herrn spielen iron play the great lady/lord;große Reden schwingen iron talk big;Groß und Klein standesmäßig: high and low6. (allgemein, wesentlich) broad, general;den großen Zusammenhang erkennen see the big picture;im großen Ganzen overall;in großen Zügen in broad outline7. umg (gut):das war ganz groß! that was really great!;große Klasse she’s really good ( oder she’s brilliant) at arithmetic;im Angeben/Geldausgeben ist er (ganz) groß iron he’s very good at showing off/spending money;ich bin kein großer Freund von Partys/Suppe I’m not a great one for parties/soup, I’m not particularly fond of parties/soup;er ist ein großer Schweiger/kein großer Esser he’s not a great talker/eater8. (edel):in großer Aufmachung Bericht etc: prominently featured, splashed across the page; Person: in full dress;B. adv1. big;groß gedruckt in large letters ( oder print);groß gemustert with a large pattern;groß kariert large-checked;er sah mich nur groß an he just stared at me;groß und breit dastehen umg, unübersehbar: stand out; stärker: stick out like a sore thumb; → auch großschreiben, großgebaut etc2. (aufwändig):groß angelegt Aktion etc: large-scale, full-scale;groß ausgehen umg have a real night out;jemanden/etwas groß herausbringen umg pull out all the stops for sb/sth, give sb/sth a tremendous build-up3. umg:groß auftreten act big;groß daherreden talk big5. (gut):groß in Form in great form;beim Publikum groß ankommen be a big hit with the audience;ganz groß dastehen (Erfolg haben) do brilliantly6. umg:er kümmert sich nicht groß darum he doesn’t really bother about it;was ist schon groß dabei? so what?, US auch (so) what’s the big deal?;was gibt es da groß zu sagen? what can you say?;was gibt’s da noch groß zu fragen? is there really anything more we need to ask?;was kann das schon groß kosten? it can’t be very expensive, can it?;was war los? -was soll schon groß gewesen sein? what do you think happened?* * *1.größer, größt... Adjektiv1) big; big, large <house, window, area, room, etc.>; large <pack, size, can, etc.>; great <length, width, height>; tall < person>große Eier/Kartoffeln — large eggs/potatoes
eine große Terz/Sekunde — (Musik) a major third/second
ein großes Bier, bitte — a pint, please
1 m2/2 ha groß — 1 m2/2 ha in area
sie ist 1,75 m groß — she is 1.75 m tall
doppelt/dreimal so groß wie... — twice/three times the size of...
3) (älter) big <brother, sister>unsere Große/unser Großer — our eldest or oldest daughter/son
4) (erwachsen) grown-up <children, son, daughter>[mit etwas] groß werden — grow up [with something]
die Großen — (Erwachsene) the grown-ups; (ältere Kinder) the older children
Groß und Klein — old and young [alike]
5) (lange dauernd) long, lengthy <delay, talk, explanation, pause>die großen Ferien — (Schulw.) the summer holidays or (Amer.) long vacation sing.
die große Pause — (Schulw.) [mid-morning] break
große Summen/Kosten — large sums/heavy costs
eine große Auswahl — a wide selection or range
7) (außerordentlich) great <pleasure, pain, hunger, anxiety, hurry, progress, difficulty, mistake, importance>; intense <heat, cold>; high < speed>ihre/seine große Liebe — her/his great love
ein großer Augenblick/Tag — a great moment/day
große Worte — grand or fine words
[k]eine große Rolle spielen — [not] play a great or an important part
die Großen [der Welt] — the great figures [of our world]
9) nicht präd. (glanzvoll) grand <celebration, ball, etc.>die große Dame/den großen Herrn spielen — (iron.) play the fine lady/gentleman
10) (bedeutend) great, major <artist, painter, work>Katharina die Große — Catherine the Great; s. auch Karl
11) (wesentlich)die große Linie/der große Zusammenhang — the basic line/the overall context
in großen Zügen od. Umrissen — in broad outline
im Großen [und] Ganzen — by and large; on the whole
13) (ugs.): (großspurig)2.große Reden schwingen od. (salopp) Töne spucken — talk big (coll.)
1)groß geschrieben werden — (fig. ugs.) be stressed or emphasized
groß machen — (Kinderspr.) do number two (child lang.)
2) (ugs.): (aufwendig)3) (ugs.): (besonders) greatly; particularly4) (ugs.): (großartig)sie steht ganz groß da — she has made it big (coll.) or made the big time (coll.)
* * *adj.ample adj.big adj.capital adj.great adj.heavyset adj.large adj.sizable adj.tall adj. adv.largely adv.sizably adv. -
10 Ventilsitzbreite
f <kfz.mot> ■ seat width pract ; valve seat width; valve margin -
11 полоса
1) General subject: band, bar, fascia, field, frequence band, heatwave, hi-lo-band, marge, margin, page, period (Бессмысленная полоса напряжения в отношениях - pointless period of tension in a relationship - think of black and white stripes (полосы) that a relationship drives across), plate, run, series (a series of stamps (coins) - серия марок (монет)), stripe, tract, wale (от удара плетью, прутом), weal (от удара плетью, прутом), welt, wheal (от удара плетью), width, zone, column (Newspaper column), patch (rough / sticky patch - полоса напряжения в отношениях)2) Geology: ribbon5) Military: area, (патронная) belt, corridor, front (наступления, обороны), sector, spectrum (частот), window6) Engineering: fringe, passband (пропускания), piece, reed stripe (дефект проката), section bar, sheet, sideband (боковая), strap iron, stretch, stringer (вид переноса материала при трении), stripe (цветовая линия), tape, trail9) Automobile industry: billot10) Architecture: plate (металла, стекла и т.п.), zone (в значении "район", "местность")12) Mining: rib, ribbing (угля), split (при выемке)13) Road works: lane, traffic lane (движения)14) Forestry: lane (деревьев)15) Polygraphy: bar (напр. краски), page (набора), (отпечатанная) page ribbon, page-boy, printed side, sliver18) Oil: stria19) Communications: (информационная) bar20) Fishery: streak (на поверхности воды)24) Sowing: list25) Drilling: region26) Sakhalin energy glossary: flat bar27) Polymers: fringe (интерференционная)28) Automation: (интерференционная) fringe, strapping29) Robots: pass (пропускания)30) Arms production: knife blank (ножа)32) Makarov: band (напр. частот), band (напр., частот), bar (света, цвета), bar (сортового металла), beam, belt (пояс, зона), frequency band, frequency range, lamel, lamella, page ribbon (отпечатанная), reach (территории), slip, strand, streak (суши или воды), strip (узкая пластинка, удлинённый кусок, напр. металла, ткани и т.п.)33) Melioration: bed (площадь между двумя соседними разъёмными бороздами)34) Internet: Bandwidth (Диапазон частот, передаваемых через данное устройство или среду. Более широкая полоса позволяет передать больше информации в единицу времени)35) SAP.tech. horizontal bar -
12 полоса
1) stripe, streak; strip; band, flat bar (железа и т.д.)
2) (от удара кнутом и т.п.) wale
3) (область) region* * ** * *stripe, streak; strip; band, flat bar* * *barbillotfasciamarginstreakstripstripewidth -
13 полоса
band имя существительное:
См. также в других словарях:
Margin of error — This article is about the statistical precision of estimates from sample surveys. For safety margins in engineering, see Factor of safety. For tolerance in engineering, see Tolerance (engineering). Not to be confused with Margin for Error. The… … Wikipedia
Margin (typography) — A diagram displaying equal margins of width 25mm on an A4 page. In typography, a margin is the space that surrounds the content of a page.[1] The margin helps to define where a line of text begins and ends. When a page is justified the text is… … Wikipedia
margin stop — noun or marginal stop : either of the stops (as on a typewriter) that limit the range of the printing and determine the width of the margins … Useful english dictionary
valve margin — The width of the edge of the valve head between the top of the valve and the edge of the face. Too narrow a margin results in preignition and valve damage through over heating … Dictionary of automotive terms
suborbital width — least distance between the orbit and the lower suborbital or preorbital margin … Dictionary of ichthyology
List of Yellowcard band members — Yellowcard is a pop punk band founded in 1997 in Jacksonville, Florida. Throughout the band s history, Yellowcard has only had one consistant member, being drummer Longineu W. Parsons III. This is a timeline of all of the band members since their … Wikipedia
Duktales Karzinom in situ — Klassifikation nach ICD 10 D05.1 Carcinoma in situ der Milchgänge … Deutsch Wikipedia
Turkey Run State Park — Turkey Run Designation State Park Location Indiana USA Nearest City Marshall, Indiana Coordinates coord|39|53.1|N|87|12.2|W|type:landmark region:US Area 2,382 acres Date of Establishment 1916 … Wikipedia
Potato Creek State Park — Potato Creek Designation State Park Location Indiana USA Nearest City North Liberty, Indiana Coordinates coord|41|55|N|86|35|W|type:landmark region:US Area 3,840 acres Date of Establishment 1969 Gov … Wikipedia
White River State Park — Designation State Park Location Indiana USA Nearest City Indianapolis, Indiana Area 250 acres Date of Establishment 1979 Governing Body [http://www.in.gov/whiteriver/about/admin.htm … Wikipedia
Summit Lake State Park — Summit Lake Designation State Park Location Indiana USA Nearest City New Castle, Indiana Coordinates coord|40|02|N|85|33|W|type:landmark region:US Area 2,680 acres Date of Establishment 1988 Governing Body … Wikipedia